Sponsored by..

Thursday, 26 July 2012

"Federal Tax transfer" spam / retweetadministrator.org

These fake "Federal Tax Transfer" spams lead to malware on retweetadministrator.org:


Date:      Thu, 26 Jul 2012 20:56:10 +0530
From:      "Internal Revenue Service" [alerts@irs.gov]
Subject:      Federal Tax transfer returned

Your federal Tax payment (ID: 632004160993), recently from your checking account was rejected by the your financial institution.

Canceled Tax transfer
Tax Transaction ID:     632004160993
Rejection Reason     See details in the report below
Tax Transaction Report     tax_report_632004160993.doc (Microsoft Word Document)


Internal Revenue Service, Metro Plex 1, 8401 Corporate Drive, Suite 300, Landover, MD 20785


==========

Date:      Thu, 26 Jul 2012 20:55:41 +0530
From:      "Internal Revenue Service" [support@irs.gov]
Subject:      Rejected Federal Tax transaction

Your Tax payment (ID: 766644379032), recently initiated from your checking account was rejected by the your financial institution.

Rejected Tax transfer
Tax Transaction ID:     766644379032
Reason of rejection     See details in the report below
FederalTax Transaction Report     tax_report_766644379032.doc (Microsoft Word Document)


Internal Revenue Service, Metro Plex 1, 8401 Corporate Drive, Suite 300, Landover, MD 20785

==========

Date:      Thu, 26 Jul 2012 12:00:54 -0300
From:      "Internal Revenue Service" [support@irs.gov]
Subject:      Rejected Federal Tax transfer

Your federal Tax payment (ID: 776394251906), recently from your checking account was returned by the your financial institution.

Canceled Tax transfer
Tax Transaction ID:     776394251906
Reason of rejection     See details in the report below
FederalTax Transaction Report     tax_report_776394251906.doc (Microsoft Word Document)


Internal Revenue Service, Metro Plex 1, 8401 Corporate Drive, Suite 300, Landover, MD 20785


The malicious payload is on [donotclick]retweetadministrator.org/main.php?page=8b45f871830c6e5a (report here) hosted on 89.253.231.202 (Rusonyx Ltd, Moscow).

"Adobe CS4 License" spam / online-gaminatore.ru

This "Adobe CS4 License" spam leads to malware on online-gaminatore.ru:


Date:      Thu, 26 Jul 2012 09:24:01 +0900
From:      FentonpJsGh9LIsiah@aol.com
Subject:      Order N81149


Dear Sirs,


You can download your Adobe CS4 License here -


We encourage you to explore its new and enhanced capabilities with these helpful tips, tutorials, and eSeminars.

Thank you for buying Adobe InDesign CS4 software.


Adobe Systems Incorporated

The malicious payload is at [donotclick]online-gaminatore.ru:8080/forum/showthread.php?page=5fa58bce769e5c2c (report here) hosted on the following IPs:


89.111.177.151 (Garant-Park-Telecom, Russia)
78.83.233.242 (Spectrum Net JSC, Bulgaria)


These IPs should be blocked if you can.

Wednesday, 25 July 2012

"Wire Transfer" spam / furnitura-forums.ru

This fake "Wire Transfer" spam (or is it UPS?) leads to malware on furnitura-forums.ru:


Date: Wed, 25 Jul 2012 09:12:43 -0500
From: "Express MyUps" [upsservices@ups.com]
Subject: Fwd: Re: Wire Transfer
Attachments: Wire_ID88283.htm

Dear Operator,



WIRE FID: NO-004394626739460



STATUS: CANCELLED



You can find details in the attached file.

The attachment Wire_ID88283.htm attempts to load malware from [donotclick]furnitura-forums.ru:8080/forum/showthread.php?page=5fa58bce769e5c2c (report here) hosted on the following IPs:

78.83.233.242 (Spectrum Net JSC, Bulgaria)
203.80.16.81 (Myren, Malaysia)



..these two IP addresses also host some other malware sites and are worth blocking:
porschedesignrussia.ru
bmwforummsk.ru
phpforkiddies.ru
forumanarhist.ru

US Airways spam / reformattedfilmmaker.org and algebrayep.org

This fake US Airways spam leads to malware on reformattedfilmmaker.org:

Date: Wed, 25 Jul 2012 09:46:57 -0500
From: "US Airways - Reservations" [support@myusairways.com]
Subject: Confirm your US airways online reservation.

You should check in from 24 hours and up to 60 minutes before your flight (2 hours if you're flying abroad). After that, all you have to do is print your boarding pass and go to the gate.

Confirmation code: 210916

Check-in online: Online reservation details

Flight

4817
Departure city and time

Washington, DC (DCA) 10:00PM

Depart date: 7/26/2012


We are committed to protecting your privacy. Your information is kept private and confidential. For information about our privacy policy visit usairways.com.

US Airways, 111 W. Rio Salado Pkwy, Tempe, AZ 85281 , Copyright US Airways , All rights reserved.

The malicious payload is at [dotnotclick]reformattedfilmmaker.org/main.php?page=70ec803a01c84ddc (report here) hosted on the same Chinese IP address of 221.131.129.200 that was used in a similar spam run yesterday.

UPDATE: a similar US Airways spam run is also underway with a malicious payload on algebrayep.org on the same IP address.

Tuesday, 24 July 2012

PayPal Spam / teloexpressions.org

These fake PayPal spams lead to malware on teloexpressions.org:


Date:      Tue, 24 Jul 2012 18:06:49 +0330
From:      "Allan Marquez" <notify@paypal.com>
Subject:      Paypal has sent you a bank transfer.

<tr =="" valign="top">
<table =="" border="0" cellpadding="0" cellspacing="0" width="100%">

We are moving funds from Your Paypal account to your bank account.

Total amount transferred     $ 131.54
Bank account     BANK OF AMERICA
Transaction ID     59566237893344612

<div style="text-align: center;" class="footerLinks" 5px="" 0;="" padding:="">Help Center Resolution Center Security Center

Please don't reply to this email. It'll just confuse the computer that sent it and you won't get a response.

Copyright 2012 PayPal, Inc. All rights reserved. PayPal is located at 2211 N. First St., San Jose, CA 95131.

==========


Date:      Tue, 24 Jul 2012 11:33:00 -0300
From:      "Jody Wade" <notify@paypal.com>
Subject:      Paypal transfer to your bank account initiated.

<tr =="" valign="top">
<table =="" border="0" cellpadding="0" cellspacing="0" width="100%">

We are transferring funds from Your Paypal account to your bank account.

Total amount transferred     $ 944.68
Bank account     BANK OF NORTH CAROLINA
Transaction ID     67081555155766933

<div style="text-align: center;" class="footerLinks" 5px="" 0;="" padding:="">Help Center Resolution Center Security Center

Please don't reply to this email. It'll just confuse the computer that sent it and you won't get a response.

Copyright 2012 PayPal, Inc. All rights reserved. PayPal is located at 2211 N. First St., San Jose, CA 95131.

==========


Date:      Tue, 24 Jul 2012 11:10:58 -0300
From:      "Evan Battle" <notify@paypal.com>
Subject:      We have sent you a bank transfer.

<tr =="" valign="top">
<table =="" border="0" cellpadding="0" cellspacing="0" width="100%">

We are sending funds from Paypal to your bank account.

Total amount transferred     $ 123.59
Bank account     CITYBANK
Transaction ID     55273357044211327

<div style="text-align: center;" class="footerLinks" 5px="" 0;="" padding:="">Help Center Resolution Center Security Center

Please don't reply to this email. It'll just confuse the computer that sent it and you won't get a response.

Copyright 2012 PayPal, Inc. All rights reserved. PayPal is located at 2211 N. First St., San Jose, CA 95131.

==========


Date:      Tue, 24 Jul 2012 19:15:46 +0530
From:      "service@paypal.com" <service@paypal.com>
Subject:      Paypal transfer to your bank account initiated.

<tr =="" valign="top">
<table =="" border="0" cellpadding="0" cellspacing="0" width="100%">

We are moving funds from Paypal to your bank account.

Total amount transferred     $ 425.21
Bank account     BANK OF NORTH CAROLINA
Transaction ID     17744199446279262

<div style="text-align: center;" class="footerLinks" 5px="" 0;="" padding:="">Help Center Resolution Center Security Center

Please don't reply to this email. It'll just confuse the computer that sent it and you won't get a response.

Copyright 2012 PayPal, Inc. All rights reserved. PayPal is located at 2211 N. First St., San Jose, CA 95131.

==========


Date:      Tue, 24 Jul 2012 09:45:45 -0400
From:      "service@paypal.com" <service@paypal.com>
Subject:      Paypal has sent you a bank transfer.

<tr =="" valign="top">
<table =="" border="0" cellpadding="0" cellspacing="0" width="100%">

We are moving funds from Your Paypal account to your bank account.

Total amount transferred     $ 191.22
Bank account     CITYBANK
Transaction ID     64722827521858421

<div style="text-align: center;" class="footerLinks" 5px="" 0;="" padding:="">Help Center Resolution Center Security Center

Please don't reply to this email. It'll just confuse the computer that sent it and you won't get a response.

Copyright 2012 PayPal, Inc. All rights reserved. PayPal is located at 2211 N. First St., San Jose, CA 95131.


The malicious payload is at [donotclick]teloexpressions.org/main.php?page=9aca5bbc34d3ebd6 (report here) hosted on 221.131.129.200 which we have seen before and is definitely worth blocking.

Monday, 23 July 2012

"Hi, we think you may be entitled to compensation.." SMS spam

The PPI claim spammers are back again, this time using the throwaway number of +447969662555

Hi, we think you may be entitled to compensation of up to £3500 from missold PPI on a credit card or loan.
Reply PPI for more info
Reply STOP to opt out
Obviously they think nothing of the sort and are just randomly spamming, even to mobile phone numbers registered with TPS. Given that their pitch is based on a lie, it's likely that the whole outfit it some sort of scam in any case.

If you get one of these, you should forward the spam and the sender's number to your carrier. In the came of T-Mobile, O2 and Orange the number to report to is 7726 ("SPAM"). Vodafone customers should use 87726 ("VSPAM") and Three customers should use 37726 ("3SPAM"). Hopefully the carriers will act if there are enough complaints.

Friday, 20 July 2012

Wire Transfer spam / porschedesignrussia.ru

This fake wire transfer spam leads to malware on porschedesignrussia.ru:

Date:      Fri, 20 Jul 2012 04:10:52 +0100
Subject:      RE: Your Wire Transfer N02526593

Good morning,

Wire debit transfer was canceled by the other financial institution.



Canceled transfer:

FED REFERENCE NUMBER: ISL9653367088ODP06829K

Transfer Report: View



Federal Reserve Wire Network

The malicious payload is at [donotclick]porschedesignrussia.ru:8080/forum/showthread.php?page=5fa58bce769e5c2c (report here) hosted on the following IPs:
78.83.233.242
203.80.16.81
213.17.171.186

These are the same IP addresses as used in this attack from yesterday. Blocking them would probably be prudent.

Thursday, 19 July 2012

AICPA spam / jeffknitwear.org

I haven't seen this fake AICPA spam for a while, but here it is.. this time leading to a malicious payload on the domain jeffknitwear.org:

Date:      Thu, 19 Jul 2012 17:03:06 +0300
From:      "Lakisha Rush" [support@aicpa.org]
Subject:      Termination of your accountant license.

You're receiving this notification as a Certified Public Accountant and a member of AICPA.
Having trouble reading this email? View it in your browser.

Cancellation of Accountant status due to income tax fraud allegations

Dear AICPA member,

We have received a complaint about your possible participation in income tax refund fraudulent activity for one of your clients. According to AICPA Bylaw Paragraph 730 your Certified Public Accountant license can be withdrawn in case of the fact of filing of a misguided or fraudulent tax return for your client or employer.

Please be informed of the complaint below and respond to it within 7 days. The failure to respond within this term will result in cancellation of your CPA license.

Complaint.pdf

The American Institute of Certified Public Accountants.

Email: service@aicpa.org
Tel. 888.777.7077
Fax. 800.362.5066

==========

Date:      Thu, 19 Jul 2012 14:02:48 +0000
From:      "Jonathan Gallagher" [support@aicpa.org]
Subject:      Fraudulent tax return assistance accusations.

You're receiving this email as a Certified Public Accountant and a member of AICPA.
Having trouble reading this email? View it in your browser.

Cancellation of Accountant status due to income tax fraud allegations

Dear accountant officer,

We have been notified of your possible involvement in tax return fraudulent activity for one of your employees. According to AICPA Bylaw Paragraph 730 your Certified Public Accountant license can be cancelled in case of the occurrence of presenting of a misguided or fraudulent income tax return on the member's or a client's behalf.

Please familiarize yourself with the notification below and respond to it within 14 days. The failure to provide the clarifications within this time-frame will result in termination of your Accountant status.

Complaint.pdf

The American Institute of Certified Public Accountants.

Email: service@aicpa.org
Tel. 888.777.7077
Fax. 800.362.5066

The malicious payload is at [donotclick]jeffknitwear.org/main.php?page=8614d3f3a69b5162 (report here) hosted on 221.131.129.200 (China Mobile, China). The following domains are on the same server and you should either block the IP or these domains too:

checkingservices.net
historyalmostany.org
jeffknitwear.org
lefttorightproductservice.org
toeplunge.org
yourfirstwall.com
visorwordprocessor.org

"Fwd: Wire Transfer (9579GQ518) " spam / forumanarhist.ru

This fake wire transfer spam leads to malware at forumanarhist.ru:


Date:      Thu, 19 Jul 2012 02:56:36 -0400
From:      CABALLEROFANNYcRU@aol.com
Subject:      Fwd: Wire Transfer (9579GQ518)
Attachments:     Wire_AMBA01-Rejected.htm


Dear Operator,



WIRE N: FD-1059598546520289



STATUS: REJECTED



You can find details in the attached file.


The malicious attachment is named Wire_AMBA01-Rejected.htm and contains a redirector to [donotclick]forumanarhist.ru:8080/forum/showthread.php?page=5fa58bce769e5c2c (report here)

That site is multhomed at the following IPs:
78.83.233.242
203.80.16.81
213.17.171.186

There are some additional IPs and domains that can be found in this post that should also be blocked.

"Wire Transfer" spam / phpforkiddies.ru

This spam contains an attachment leading to malware on phpforkiddies.ru:


Date:      Wed, 18 Jul 2012 01:23:20 +0300
From:      "EUNA Wood" [AdamWnukowski@himsa.com.mx]
Subject:      Fwd: Wire Transfer (75073UQ608)
Attachments:     Wire_NFED_Rejected.htm

Dear Operator,



WIRE N: FED-9058663000926019



STATUS: REJECTED



You can find details in the attached file.
The attachment in this case is called Wire_NFED_Rejected.htm and contains a script that attempts to load malware from [donotclick]phpforkiddies.ru:8080/forum/showthread.php?page=5fa58bce769e5c2c (report here) which is multihomed on the following IPs:


The following IPs and domains are connected and should be blocked:
41.66.137.155
50.57.43.49
62.76.186.75
62.76.188.120
62.213.64.161
78.83.233.242
85.143.166.243
87.120.41.155
89.111.177.151
173.203.96.79
184.106.189.124
193.109.144.51
203.80.16.81
203.172.140.202
213.17.171.186

bmwforummsk.ru
forumenginesspb.ru
hamlovladivostok.ru
mazdaontours.ru
phpforkiddies.ru
porscheforumspb.ru

Tuesday, 17 July 2012

Fake Craigslist emails / visorwordprocessor.org

These fake Craigslist emails lead to malware on visorwordprocessor.org:


Date:      Tue, 17 Jul 2012 09:01:11 -0500
From:      "craigslist - automated message, do not reply" [robot@craigslist.org]
Subject:      Your Craiglist.org posting URL.

Posting ID # 27643127:

    "Double Stainless Steel Sink" (household items - by owner)

Should now be accessible at the following URL:

    http://craigslist.org/hsh/262383.html

Index pages and search results are updated every 15 minutes.

To edit or delete, please log in to your member area.

If you are having trouble finding your posting in the listings:

    http://www.craigslist.org/about/help/how_to_fi= nd_your_post_in_the_listings

For other questions or help:

    http://w= ww.craigslist.org/about/help/

Safety tips and avoiding scams:

    http://= www.craigslist.org/about/safety
    http://www.craigslist.o= rg/about/scams

Thanks for using craigslist!

==========


Date:      Tue, 17 Jul 2012 06:00:52 -0800
From:      "craigslist - automated message, do not reply" [robot@craigslist.org]
Subject:      Your Craiglist posting is successful.

Posting ID # 14717917:

    "Turbo 400 Tranny" (household items - by owner)

Should now be accessible at the following URL:

    http://craigslist.org/hsh/888725.html

New postings are updated every 15 minutes.

To edit or delete, please log in to your member area.

If you are having trouble finding your item in the listings:

    http://www.craigslist.org/about/help/how_to_fi= nd_your_post_in_the_listings

For other questions or help:

    http://w= ww.craigslist.org/about/help/

Safety tips and avoiding scams:

    http://= www.craigslist.org/about/safety
    http://www.craigslist.o= rg/about/scams

Thanks for using craigslist!

==========


Date:      Tue, 17 Jul 2012 15:13:26 +0200
From:      "craigslist - automated message, do not reply" [robot@craigslist.org]
Subject:      Your Craiglist posting is successful.

Posting ID # 49685217:

    "Generator" (household items - by owner)

Should now be viewable at the following URL:

    http://craigslist.org/hsh/887563.html

New postings are updated every 15 minutes.

To edit or delete, please log in to your account.

If you are experiencing problems finding your posting in the listings:

    http://www.craigslist.org/about/help/how_to_fi= nd_your_post_in_the_listings

For other questions or help:

    http://w= ww.craigslist.org/about/help/

Safety tips and avoiding scams:

    http://= www.craigslist.org/about/safety
    http://www.craigslist.o= rg/about/scams

Thanks for using craigslist!

==========


Date:      Tue, 17 Jul 2012 10:09:15 -0300
From:      "craigslist - automated message, do not reply" [robot@craigslist.org]
Subject:      You can access your Craiglist listing by the new location.

Posting ID # 35649793:

    "Screwdrivers kit" (household items - by owner)

Can now be viewable at the following location:

    http://craigslist.org/hsh/284761.html

Index pages and search results are updated every 15 minutes.

To edit or delete, please log in to your account.

If you are having trouble finding your item in the listings:

    http://www.craigslist.org/about/help/how_to_fi= nd_your_post_in_the_listings

For other questions or help:

    http://w= ww.craigslist.org/about/help/

Safety tips and avoiding scams:

    http://= www.craigslist.org/about/safety
    http://www.craigslist.o= rg/about/scams

Thanks for using craigslist!

The malicious payload is at [donotclick]visorwordprocessor.org/main.php?page=ed0a25d616022c57 (report here) hosted on 91.227.18.26 (Eximus LLC, Russia). The namesevers are at good-autosport.com which links this attack in with this one earlier today.

Intuit "Henderson LLC" payment spam / mailmergesfinger.org

This fake Intuit spam leads to malware on mailmergesfinger.org:


Date:      Mon, 16 Jul 2012 18:10:26 +0000
From:      "Intuit PaymentNetwork" [support@intuit.com]
Subject:      You have received a new payment through the Intuit network.




Payment received: You received $280.00 from Henderson LLC for invoice 91816

You can access the payment details here.

Funds will be deposited in your bank account.

You now have the possibility to get paid by Credit Card on your invoices. To find put more please sign in to your IPN account and click on the 'Profile' tab on the left.


The malicious payload is at [donotclick]mailmergesfinger.org/main.php?page=bfc8be54a0120bca (report here) hosted on 94.249.172.71 (GHOSTnet, Germany).

The following IPs and domains are connected and should be avoided or blocked:
13.65.99.23
46.20.33.131
62.109.26.35
78.129.132.14
80.77.87.185
94.249.172.71
108.76.72.229
109.164.221.176
164.15.250.148
195.54.32.91
198.144.189.51
200.184.213.131
211.157.105.160

afriget.net
cms-wideopendns.com
fonografs.net
good-autosport.com
mailmergesfinger.org
peace-computer.com
proamd-inc.com
thaidescribed.com

Monday, 16 July 2012

"Intuit Payroll Services" spam / cms-wideopendns.com

These (rather confused) spam emails lead to malware on cms-wideopendns.com:

From: LinkedIn Communication [mailto:support@intuit.com]
Sent: 16 July 2012 15:12
Subject: We have received your payroll processing request.




Direct Deposit Service Communication
Status update

Dear victim
We received your payroll on July 16, 2012 at 1:16 AM Pacific Time.
•    Funds will be withdrawn from the bank account number ending in: XXXX on July 17, 2012.
•    Amount to be withdrawn: $2,476.11
•    Paychecks will be deposited to your employees' accounts on: July 17, 2012
•    Please download your payroll here.
Funds are as a rule processed before normal banking hours so please make sure you have sufficient funds available by 12 a.m. on the date funds are to be withdrawn.
Intuit must receive your payroll by 5 p.m. Pacific time, two banking days before your payment date or your employees will fail to be paid on time. QuickBooks does not process payrolls on weekends or federal banking holidays. A list of federal banking holidays can be downloaded at the Federal Reserve website.
Thank you for your business.
Sincerely,
Intuit Payroll Services



IMPORTANT NOTICE: This notification is being sent to inform you of a critical matter concerning your current service or software. Please note that if you previously opted out of receiving marketing materials from Intuit, you may continue to receive notifications similar to this communication that affect your service or software.
If you have any questions or comments about this email, please DO NOT REPLY to this email. If you need additional information please contact us.
If you receive an email message that appears to come from Intuit but that you suspect is a phishing email, please forward it to immediately to spoof@intuit.com.
Copyright 2008 Intuit Inc. QuickBooks and Intuit are registered trademarks of and/or registered service marks of Intuit Inc. in the United States and other countries. This notification is not intended to supplement, modify, or extend the Intuit software license agreement between you and Intuit for any Intuit product or service.
Intuit Inc. Customer Communications
2800 E. Commerce Center Place, Tucson, AZ 85706


====================

From: LinkedIn Communication [support@intuit.com]
Sent: Mon 16/07/2012 15:12
Subject: Your payroll processing is initiated by Intuit.

Direct Deposit Service Communication
Status update

Dear victim
We obtained your payroll on July 16, 2012 at 7:36 AM Pacific Time.
•    Funds will be withdrawn from the bank account number ending in: XXXX on July 17, 2012.
•    Amount to be withdrawn: $5,582.11
•    Paychecks will be deposited to your employees' accounts on: July 17, 2012
•    Please download your payroll here.
Funds are typically withdrawn before normal banking hours so please make sure you have sufficient funds available by 12 a.m. on the date funds are to be withdrawn.
Intuit must receive your payroll by 5 p.m. Pacific time, two banking days before your payment date or your employees will fail to be paid on time. QuickBooks does not process payrolls on weekends or federal banking holidays. A list of federal banking holidays can be downloaded at the Federal Reserve website.
Thank you for your business.
Sincerely,
Intuit Payroll Services



IMPORTANT NOTICE: This notification is being sent to inform you of a critical matter concerning your current service or software. Please note that if you previously opted out of receiving marketing materials from Intuit, you may continue to receive notifications similar to this communication that affect your service or software.
If you have any questions or comments about this email, please DO NOT REPLY to this email. If you need additional information please contact us.
If you receive an email message that appears to come from Intuit but that you suspect is a phishing email, please forward it to immediately to spoof@intuit.com.
Copyright 2008 Intuit Inc. QuickBooks and Intuit are registered trademarks of and/or registered service marks of Intuit Inc. in the United States and other countries. This notification is not intended to supplement, modify, or extend the Intuit software license agreement between you and Intuit for any Intuit product or service.
Intuit Inc. Customer Communications
2800 E. Commerce Center Place, Tucson, AZ 85706


LinkedIn? Intuit? The bad guys are confused, but these are dangerous emails nonetheless. The malicious payload is at [donotclick]cms-wideopendns.com/main.php?page=bfc8be54a0120bca (report here) hosted on the following IPs:

211.157.105.160 (Chinacomm, China)
109.164.221.176 (Swisscom, Switzerland)



The following IPs and domains are all connected and should be blocked:
46.20.33.131
62.109.26.35
80.77.87.185
108.76.72.229
109.164.221.176
164.15.250.148
195.54.32.91
198.144.189.51
211.157.105.160

afriget.net
cms-wideopendns.com
fonografs.net
peace-computer.com
proamd-inc.com
thaidescribed.com

Sunday, 15 July 2012

Facebook "Error message [404] 404 Not Found" email messages

This one has me scratching my head.. a series of emails this morning with subjects similar to the following:

Error message [404] 404 Not Found for m.facebook.com/media/set/?set=a.[redacted].8100.100000762125833
Error message [404] 404 Not Found for m.facebook.com/pokes/?refid=7
Error message [404] 404 Not Found for m.facebook.com/home.php?sk=photodash


The emails appear to originate from a Yahoo! IP address, the sender's email address matches a registered Facebook account and in one case the URL in the subject links to a gallery from the same user. But I don't know who these people are, and the email address sent to is a rarely used one that has NEVER been used for Facebook.

In most cases the email is blank, in one case there is a photograph of a BlackBerry, apparently taken yesterday from a Samsung GT-C6625 (an oldish Windows Mobile device). The IP headers indicate that this is maybe coming through a mobile version of Yahoo! mail. An infected mobile phone perhaps?

It's all kind of odd, perhaps it is the precursor to something else?

Wednesday, 11 July 2012

UPS Spam / peace-computer.com

This fake UPS spam leads to malware on peace-computer.com:


Date:      Wed, 11 Jul 2012 09:51:41 -0500
From:      "Margret Bellamy" [USPS_Shipping_Services@usps.com]
Subject:      Download your UPS invoices.


   
This is an automatically generated email Please do not reply to this email address.

Dear UPS Customer,

New invoice(invoices) are available for viewing in UPS billing center. Please note that your UPS invoices should be paid within 14 days to avoid any additional charges.



Please visit the UPS Billing Center to view and pay your invoice.



Find out more about UPS:
Visit ups.com
Explore UPS Freight Services
Learn About UPS Companies
Sign Up For Additional Email From UPS
Read our official journal

(c) 2012 United Parcel Service of America, Inc. UPS, the UPS brandmark, and the color brown are trademarks of United Parcel Service of America, Inc. All rights reserved.
For more information on UPS's privacy practices, refer to the UPS Privacy Policy.
Please do not reply directly to this e-mail. UPS will not receive any reply message.
For questions or comments, visit Contact UPS.

This communication contains proprietary information and may be confidential. If you are not the intended recipient, the reading, copying, disclosure or other use of the contents of this e-mail is strictly prohibited and you are instructed to please delete this e-mail immediately.
Privacy Policy
Contact UPS

The malicious payload is at [donotclick]peace-computer.com/main.php?page=22b33afad06e9ba5
on 62.109.26.35 (ISPsystem, Russia). The following domains and IPs are all connected to this attack:

afriget.net
ecocabmedia.net
fonografs.net
ghanarpower.net
hotspotboutique.net
itleadgenie.net
lessthansmoothmasculine.com
nectarstuff.net
sitkatacotruck.com
speciallyregarding.com
thaidescribed.com
yourcheckservice.com
46.105.254.202
62.109.26.35
92.201.139.15
109.164.221.176
109.169.87.169
158.25.100.139
164.15.250.148
173.234.9.84
209.59.210.119
211.157.105.160

Spam: Your Amazon.com order of "GoPro HD Helmet HERO Camcorder - Silver" has shipped!

This fake Amazon spam leads to malware on savidae.net:

Sent: 11 July 2012 15:12
Subject: Your Amazon.com order of "GoPro HD Helmet HERO Camcorder - Silver" has shipped!

Hello,

Shipping Confirmation
Order # 111-8744380-4899254

Your estimated delivery date is:
Friday, July 13 2012

Track your package Thank you for shopping with us. We thought you'd like to know that we shipped this portion of your order separately to give you quicker service. You won't be charged any extra shipping fees, and the remainder of your order will follow as soon as those items become available. If you need to return an item from this shipment or manage other orders, please visit Your Orders on Amazon.com.

Shipment Details

GoPro HD Helmet HERO Camcorder - Silver $149.95
Item Subtotal: $149.95
Shipping & Handling: $0.00
Total Before Tax: $149.95
Shipment Total: $149.95
Paid by Visa: $149.95

You have only been charged for the items sent in this shipment. Per our policy, you only pay for items when we ship them to you.

Returns are easy. Visit our .
If you need further assistance with your order, please visit Customer Service.

We hope to see you again soon!
Amazon.com

The message may appear to be sent from your own email address (this is why). The malicious payload is on [donotclick]savidae.net/main.php?page=f8475ba078c011af (report here) hosted on 178.238.130.222 (BurstNet UK, allocated to an individual in Ukraine). These other domains are on the same server, their status is not known.
beingconducts.info
burstingqualcomm.info
cameratoburnergo.info
carpetingpenny.info
clevererreviewed.info
crisisproducer.info
delightsmalwarespywarefree.info
elsedefer.info
enotatepreview.info
expostypes.info
insigniamake.info
meetscellsafety.info
methodicaldiskinternals.info
needingshirts.info
overwhelminglymustdownload.info
premisepreliminary.info
relinquishingpin.info
restoreculled.info
ringtonererender.info
shiftvirtues.info
smartmedialaserlike.info
taxcasterbolstered.info
tubez11.cu.cc
wearguitarlike.info
woodantispy.info
xxxxlivechat.info

UPDATE:
A similar campaign is underway with a payload on peace-computer.com (the same domain is used in this attack)

Another example:

Sent: den 11 juli 2012 16:19
Subject: Your Amazon.com order of "Withings WiFi Body Scale, Black" has shipped!

Hello,

Shipping Confirmation
Order # 353-3382862-1240149

Your estimated delivery date is:
Friday, July 13 2012

Track your package Thank you for shopping with us. We thought you'd like to know that we shipped this portion of your order separately to give you quicker service. You won't be charged any extra shipping fees, and the remainder of your order will follow as soon as those items become available. If you need to return an item from this shipment or manage other orders, please visit Your Orders on Amazon.com.

Shipment Details

Withings WiFi Body Scale, Black $139.95
Item Subtotal: $139.95
Shipping & Handling: $0.00
Total Before Tax: $139.95
Shipment Total: $139.95
Paid by Visa: $139.95

You have only been charged for the items sent in this shipment. Per our policy, you only pay for items when we ship them to you.

Returns are easy. Visit our .
If you need further assistance with your order, please visit Customer Service.

We hope to see you again soon!
Amazon.com

==========

Subject: Your Amazon.com order of "Boss JWVX3Y6 7-Inch DVD/MP3/CD Widescreen Bluetooth Receiver with USB and SD Card" has shipped!

Hello,

Shipping Confirmation
Order # 087-2687938-8778762

Your estimated delivery date is:
Friday, July 13 2012

Track your package Thank you for shopping with us. We thought you'd like to know that we shipped this portion of your order separately to give you quicker service. You won't be charged any extra shipping fees, and the remainder of your order will follow as soon as those items become available. If you need to return an item from this shipment or manage other orders, please visit Your Orders on Amazon.com.

Shipment Details

Boss JWVX3Y6 7-Inch DVD/MP3/CD Widescreen Bluetooth Receiver with USB and SD Card $149.95
Item Subtotal: $149.95
Shipping & Handling: $0.00
Total Before Tax: $149.95
Shipment Total: $149.95
Paid by Visa: $149.95

You have only been charged for the items sent in this shipment. Per our policy, you only pay for items when we ship them to you.

Returns are easy. Visit our .
If you need further assistance with your order, please visit Customer Service.

We hope to see you again soon!
Amazon.com

==========

Intuit.com spam / thaidescribed.com

This spam leads to malware on thaidescribed.com:


Date:      Tue, 10 Jul 2012 13:49:59 -0300
From:      "LinkedIn Communication" [USPS_Shipping_Services@usps.com]
Subject:      New Payment through the Intuit network.

Incoming payment received: You received $840.00 from Parks LLC for invoice 53389

You can access the payment details here.

Funds will be transferred in your bank account.

You now have the opportunity to get paid by Credit Card on your invoices. To learn more please sign in to your IPN account and click on the 'Profile' tab on the left.


The malicious payload is on [donotclick]thaidescribed.com/main.php?page=8cb1f95c85bce71b (report here) hosted on 164.15.250.148 (Universite Libre de Bruxelles, Belgium). The malicious IPs and domains associated with this attack can also be found here, but you should probably block the following:


afriget.net
fonografs.net
proamd-inc.com
thaidescribed.com
80.77.87.185
164.15.250.148
200.184.213.131

UPS Spam / proamd-inc.com

This UPS spam leads to malware on proamd-inc.com:

Date:      Tue, 10 Jul 2012 20:34:41 +0200
From:      "Vernon Wade" [USPS_Shipping_Services@usps.com]
Subject:      Your UPS invoices are ready for download.


   
This is an automatically generated email Please do not reply to this email address.

Dear UPS Customer,

New invoice(invoices) are available for download in UPS billing center. Do not forget that your UPS invoices should be paid within 28 days so as not to incur any additional charges.



Please surf to the UPS Billing Center to view and pay your invoice.



Find out more about UPS:
Visit ups.com
Explore UPS Freight Services
Learn About UPS Companies
Sign Up For Additional Email From UPS
Read our official blog

(c) 2012 United Parcel Service of America, Inc. UPS, the UPS brandmark, and the color brown are trademarks of United Parcel Service of America, Inc. All rights reserved.
For more information on UPS's privacy practices, refer to the UPS Privacy Policy.
Please do not reply directly to this e-mail. UPS will not receive any reply message.
For questions or comments, visit Contact UPS.

This communication contains proprietary information and may be confidential. If you are not the intended recipient, the reading, copying, disclosure or other use of the contents of this e-mail is strictly prohibited and you are instructed to please delete this e-mail immediately.
Privacy Policy
Contact UPS

==========


Date:      Tue, 10 Jul 2012 19:20:05 +0330
From:      "Don Reyes" [USPS_Shipping_Services@usps.com]
Subject:      Please download and pay your UPS delivery charges.


   
This is an automatically generated email Please do not reply to this email address.

Dear UPS Customer,

New invoice(invoices) are available for viewing in UPS billing center. Do not forget that your UPS invoices should be paid within 28 days to avoid any additional charges.



Please visit the UPS Billing Center to view and pay your invoice.



Find out more about UPS:
Visit ups.com
Explore UPS Freight Services
Learn About UPS Companies
Sign Up For Additional Email From UPS
Read our official blog

(c) 2012 United Parcel Service of America, Inc. UPS, the UPS brandmark, and the color brown are trademarks of United Parcel Service of America, Inc. All rights reserved.
For more information on UPS's privacy practices, refer to the UPS Privacy Policy.
Please do not reply directly to this e-mail. UPS will not receive any reply message.
For questions or comments, visit Contact UPS.

This communication contains proprietary information and may be confidential. If you are not the intended recipient, the reading, copying, disclosure or other use of the contents of this e-mail is strictly prohibited and you are instructed to please delete this e-mail immediately.
Privacy Policy
Contact UPS

==========

From: Miguel Segura [mailto:USPS_Shipping_Services@usps.com]
Sent: 10 July 2012 16:47
Subject: You have outstanding UPS invoices.



   
This is an automatically generated email Please do not reply to this email address.

Valued UPS Customer,
  New invoice(invoices) are available for download in UPS billing center. Please note that your UPS invoices should be paid within 21 days so as not to incur any additional charges.

Please visit the UPS Billing Center to view and pay your invoice.



________________________________________
Find out more about UPS:
Visit ups.com
Explore UPS Freight Services
Learn About UPS Companies
Sign Up For Additional Email From UPS
Read Compass Online


________________________________________
(c) 2012 United Parcel Service of America, Inc. UPS, the UPS brandmark, and the color brown are trademarks of United Parcel Service of America, Inc. All rights reserved.
For more information on UPS's privacy practices, refer to the UPS Privacy Policy.
Please do not reply directly to this e-mail. UPS will not receive any reply message.
For questions or comments, visit Contact UPS.

This communication contains proprietary information and may be confidential. If you are not the intended recipient, the reading, copying, disclosure or other use of the contents of this e-mail is strictly prohibited and you are instructed to please delete this e-mail immediately.
Privacy Policy
Contact UPS
The malicious payload is at [donotclick]proamd-inc.com/main.php?page=8cb1f95c85bce71b (report here) hosted on 164.15.250.148 (Universite Libre de Bruxelles, Belgium).

The following domains and IPs are also involved in this attack and should be blocked:
afriget.net
fonografs.net
proamd-inc.com
thaidescribed.com
80.77.87.185
164.15.250.148
200.184.213.131

Friday, 6 July 2012

"Your Receipt and Itinerary" spam / ellomb.net

This spam leads to malware on ellomb.net:

From: Johnny Mooney [mailto:kxijgvpu@asistencia.org]
Sent: 06 July 2012 13:56
Subject: Your Receipt and Itinerary

Thank you for choosing Delta. We encourage you to review this information before your trip. If you need to contact Delta or check on your flight information, go to delta.com, call 800-221-1212 or call the number on the back of your SkyMiles© card.
Now, managing your travel plans just got easier. You can exchange, reissue and refund electronic tickets at delta.com. Take control and make changes to your itineraries at delta.com/itineraries.
Speed through the airport. Check-in online for your flight.
Flight Information
DELTA CONFIRMATION #: C1N270
TICKET #: 31894208655700
Day    Date    Flight    Status    Bkng
Class    City    Time    Meals/
Other    Seat/
Cabin
---    -----    ---------------    ------    -----    ----------------    ------    ------    -------
Sun    8 JUL    DELTA 116    OK    U    LV NYC-KENNEDY
AR SAN FRANCISCO    515P
916P    F    45A
COACH
Mon    9 JUL    DELTA 1837    OK    K    LV SAN FRANCISCO
AR NYC-KENNEDY    1230P
702A#    V    32A
COACH
Baggage and check-in requirements vary by airport and airline, so please check with the operating carrier on your ticket.
Please review Delta's check-in Requirements and baggage guidelines for details.
You must be checked in and at the gate at least 15 minutes before your scheduled departure time for travel inside the United States.
You must be checked in and at the gate at least 45 minutes before your scheduled departure time for international travel.
For tips on flying safely with laptops, cell phones, and other battery-powered devices, please visit http://SafeTravel.dot.gov.
Do you have comments about our service? Please email us to share them with us.
-----------------------------------------------------------------------------
Conditions of Carriage
Air transportation on Delta and the Delta Connection carriers is subject to Delta's conditions of carriage. They include terms governing, for example:
Limits on our liability for personal injury or death of passengers, and for loss, damage or delay of goods and baggage.
Claim restrictions, including time periods within which you must file a claim or bring an action against us
Our right to change terms of the contract
Check-in requirements and other rules establishing when we may refuse carriage
Our rights and limits of our liability for delay or failure to perform service, including schedule changes, substitution of alternative air carriers or aircraft, and rerouting
Our policy on overbooking flights, and your rights if we deny you boarding due to an oversold flight
These terms are incorporated by reference into our contract with you. You may view these conditions of carriage on delta.com, or by requesting a copy from Delta.
The malicious payload is on  [donotclick]ellomb.net/main.php?page=d502255d1a941be3 (not resolving when I tried to analyse it) hosted on 83.69.226.143 (Awax Telecom, Russia). Incidentally, 83.69.226.0/24 all looks pretty bad and is worth blocking.

Wednesday, 4 July 2012

Malware sites to block 4/7/12

These malicious domains and IPs are being used in the current "runforestrun" malware attacks. The domains are registered on a daily basis, block the IPs might be more effective in this case.

bdvkpbuldslsapeb.ru
clockworkorange.org
dernflilrdxmfnye.ru
eilqnjkoytyjuchn.ru
evilstalin.https443.net
fjgtmicxtlxynlpf.ru
gytcnulxsxpsqkfn.ru
hyoflopkupjioiqq.ru   
iekiyvsbtyozmmwy.ru
keglxucgvwhqttmi.ru
lfbovcaitdrjmkbe.ru   
npxsiiwpxqqiihmo.ru
ppsvcvrcgkllplyn.ru
qtmyeslmsoxkjbku.ru
ruhctasjmpqbyvhm.ru
skwkybckmywhrhbb.ru
smolny.https443.org
tlrnhskrgijhwtlj.ru
upmqpwyndzwzmmwy.ru
vqhtwlshzzqsltcp.ru
yrxysfyekjfooere.ru
88.198.68.110
94.100.27.16
141.136.17.97
188.138.11.75
188.211.239.249